DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG17475

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:272 Identity:80/272 - (29%)
Similarity:119/272 - (43%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLC----GVQVILGQDVAQNQSE-------SAIEPRIVGGIKAKQGQFPHQISLR-LRGEH 60
            :::||.|    .:..:....::::|.|       ...:.|::.|...:.|:..:||||: :.|.|
  Fly    10 LVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGH 74

  Fly    61 YCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHN 124
            .|||.||...||:||.|||...|   |..|..|.........|.|.. |.|..:|.|| :...||
  Fly    75 ICGGCIIDERHVLTAAHCVYGYN---PTYLRVITGTVEYEKPDAVYF-VEEHWIHCNYNSPDYHN 135

  Fly   125 DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACR 189
            |:|::||...:.|:......:|.|....|...:.::|||:....|...|.|....:|.:      
  Fly   136 DIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHV------ 194

  Fly   190 WMFYSRLPETM----------ICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPD 244
              .||...|.|          ||.|.:...|||:||||||.|:.|.:.||.:  .|..|....||
  Fly   195 --VYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVN--WGYPCALGVPD 255

  Fly   245 GYLRISKVRAWI 256
            .:..:.....||
  Fly   256 SHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/231 (32%)
Tryp_SPc 37..219 CDD:238113 62/193 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 73/231 (32%)
Tryp_SPc 50..269 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.