DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG31265

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:122/262 - (46%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLL-------CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR-LRGEHYCGGV 65
            ||:||       |..:.|:|...|....      ||.||.:|:.|..|:|:||: :.|.|.|||.
  Fly     8 LLILLAVKPPNPCESKRIVGPFPAGQSG------RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGA 66

  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVL 129
            |::...:|||||||:   :.:|| |.::..|:...:..|.....||:..|..| ....|||:|::
  Fly    67 ILNENWIITAGHCVE---NFIPA-LVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALV 127

  Fly   130 RLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF-- 192
            :|...:||:.....|.|.|........:.::|||:....|...:.|..:.|..:....|...|  
  Fly   128 KLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNR 192

  Fly   193 YSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIA 257
            .|.:....||....:..|||:||||||....|::||:.:  .|..||...||....:.....||.
  Fly   193 TSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVN--WGRPCGVGLPDVQANVYYYLDWIR 255

  Fly   258 EK 259
            .|
  Fly   256 SK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/223 (31%)
Tryp_SPc 37..219 CDD:238113 59/185 (32%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 70/223 (31%)
Tryp_SPc 39..257 CDD:238113 70/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.