DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and ea

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:293 Identity:79/293 - (26%)
Similarity:116/293 - (39%) Gaps:89/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QSESAIEPRIVGGIKAKQGQFPHQISL---RLRGE--HYCGGVIISATHVITAGHCVKHGNDVVP 87
            |..:.:..||.||:|.|..:||....:   :.:|:  |:|||.:||..:||||.|||  ....:|
  Fly   119 QCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCV--NGKALP 181

  Fly    88 ADLWSIQAGSLLLSSDGVR----------------------------IPVAEVIMHPNYATGGH- 123
            .| |.:         .|||                            :||...|.||:|..... 
  Fly   182 TD-WRL---------SGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKN 236

  Fly   124 --NDLAVLRLQSP-----------LTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSL 175
              ||:|:|||...           |..|.|:.:   ||.|.   :.:|::|||. .|:...|:..
  Fly   237 QVNDIALLRLAQQVEYTDFVRPICLPLDVNLRS---ATFDG---ITMDVAGWGK-TEQLSASNLK 294

  Fly   176 LFVQVTSISRGACRWMFYSR---LPETMICLLHSKNSGACYGDSGGPATYGGKVVGLAS------ 231
            |...|.......|:.::.|:   |.:|.:|....:...:|.||||||      ::||.:      
  Fly   295 LKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGP------LIGLDTNKVNTY 353

  Fly   232 LLLGG-------GCGRAA-PDGYLRISKVRAWI 256
            ..|.|       .||.|. |..|..:.|...||
  Fly   354 YFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/283 (27%)
Tryp_SPc 37..219 CDD:238113 63/231 (27%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 76/283 (27%)
Tryp_SPc 128..389 CDD:238113 77/284 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.