DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG11670

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:248 Identity:66/248 - (26%)
Similarity:106/248 - (42%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQFPHQISLRLRGEHY-----CGGVIISATHVITAGHCV-KHGNDVVPADLWSIQAGSLLLSSDG 104
            ||:||..:|..|.|::     |||.:||...|:||.||: .||.......:..|:.....|:...
  Fly   179 GQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAP 243

  Fly   105 VRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCV---AVDISGWGNI 165
            .|..||::.:||.| |:..::|:.:::|..|:.:...:..::|.   |.|.:   .:...|:|:.
  Fly   244 QRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLW---PMNDIPYGKLHTMGYGST 305

  Fly   166 AEKGPLSDSLLFVQVTSISRGACRWMFYSRLP----------ETMICLL-HSKNSGACYGDSGGP 219
            ....|.::.|..:.::.:....|.    |.||          .:.||.. :.||...|.||||||
  Fly   306 GFAQPQTNILTELDLSVVPIEQCN----SSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGP 366

  Fly   220 AT---------------YGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIA 257
            ..               |...:||:.|  .|..|....|..|.|:|....|||
  Fly   367 LQLNLERRRRRHTSRKHYRYYLVGITS--YGAYCRSELPGVYTRVSSYIDWIA 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/245 (26%)
Tryp_SPc 37..219 CDD:238113 51/193 (26%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.