DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG16749

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:239 Identity:72/239 - (30%)
Similarity:108/239 - (45%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLR-LRGEHYCGGVIISATHVITAGHCV--KHGNDVVPADLWSIQAGS 97
            |:|.|..:...::|..||:| ..|.|.|||.|||...|:||.||.  :..:|:      |:|.|.
  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDL------SVQYGV 87

  Fly    98 LLLSSDGVR-IPVAEVIMHP------NYATGGHNDLAVLRLQSPLTFD----ANIAAIQLATEDP 151
            ..:::.|.. :.|.::|.|.      |||    ||:::|.::.|..||    |.:...:||...|
  Fly    88 TKINATGPNVVRVKKIIQHEDYNPYNNYA----NDISLLLVEEPFEFDGVTVAPVKLPELAFATP 148

  Fly   152 PNCVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRL-PETMIC-LLHSKNSGAC 212
            ......:  :.|||..|..|.:..:|..|::...|...|......|. |...|| .:.....|.|
  Fly   149 QTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQC 213

  Fly   213 YGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            .||||||..|.|:.||:.|..:........|..|.::|:...||
  Fly   214 SGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/237 (30%)
Tryp_SPc 37..219 CDD:238113 59/199 (30%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/237 (30%)
Tryp_SPc 30..259 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.