DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG12951

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:233 Identity:73/233 - (31%)
Similarity:112/233 - (48%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLR-LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLL 99
            |:|.|..:...::|..:||| ..|.|.|||.|||...|:||.||. :|.   |||..|||.|...
  Fly    29 RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT-NGR---PADTLSIQFGVTN 89

  Fly   100 LSSDGVR-IPVAEVIMHPNY--ATGGHNDLAVLRLQSPLTFD-ANIAAIQ---LATEDPPNCVAV 157
            :|:.|.. :.:.::|.|.::  .....||:::|.::.|..|| .::|.::   ||...|.:...|
  Fly    90 ISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGV 154

  Fly   158 D--ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRL-PETMIC-LLHSKNSGACYGDSGG 218
            :  :.|||.....|.:.|:|..|.:...|...|......:. |:..|| .:.....|.|.|||||
  Fly   155 EGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGG 219

  Fly   219 PATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            |..|.|:.||:.|..:........|..|.::|:...||
  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/231 (31%)
Tryp_SPc 37..219 CDD:238113 60/193 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/231 (31%)
Tryp_SPc 30..260 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.