DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Sp7

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:236 Identity:61/236 - (25%)
Similarity:92/236 - (38%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDG-----------VRIP 108
            |.|.|..|||.:|:..:|:||.|||....:.....|.:::.|....|.|.           :::.
  Fly   160 RGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLG 224

  Fly   109 VAEVIMHPNYATGGHN---DLAVLRLQSPLTFDANIAAIQLATEDPPNCV----AVDISGWG--N 164
            :.:..:||.|.....|   |:|:|||..|:..:..|..:.|........:    .:.:||||  .
  Fly   225 IEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTT 289

  Fly   165 IAEKGPLSDSLLFVQVTSISRGACRWMFYSR---LPETMICLLHSKNSGACYGDSGGP------- 219
            .|.|..:...|   .:.......|...|.:|   |..:.:|:.......:|.||||||       
  Fly   290 TARKSTIKQRL---DLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGFD 351

  Fly   220 -ATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258
             |.|...||.     .|..|| ...|..|.|::....||.|
  Fly   352 QAWYQEGVVS-----FGNRCGLEGWPGVYTRVADYMDWIVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 58/232 (25%)
Tryp_SPc 37..219 CDD:238113 46/186 (25%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 58/232 (25%)
Tryp_SPc 137..388 CDD:238113 61/236 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.