DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:240 Identity:80/240 - (33%)
Similarity:122/240 - (50%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC-VKHGNDVVPADLWSIQAGSLL 99
            ::.||..|::|::|.|.||:....|.||..:||.:.:|||.|| |:..|   |.| |.:..| .|
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSAN---PKD-WKVSFG-FL 245

  Fly   100 LSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANI--AAIQLATED-PPNCVAVDIS 160
            ||....:..|..:::|.||:...| ||:||:||.||:.::.||  |.:..||:. |||...| ::
  Rat   246 LSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVV-VT 309

  Fly   161 GWGNIAEKGPLSDSLLFVQVTSISRGACR--WMFYSRLPETMIC--LLHSKNSGACYGDSGGP-A 220
            |||.:...|...:.|...:|..|....|.  ..:...:...|:|  .|..: ..||.|||||| .
  Rat   310 GWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGR-VDACQGDSGGPLV 373

  Fly   221 TYGGKVVGLASLLLGGGCGRAAPDG---YLRISKVRAWIAEKAGL 262
            :...|.:...:.::..|...|.|:.   |.|::..|.||:.|.||
  Rat   374 SEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKTGL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/232 (32%)
Tryp_SPc 37..219 CDD:238113 66/190 (35%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 75/232 (32%)
Tryp_SPc 187..415 CDD:238113 77/234 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.