DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk4

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:242 Identity:67/242 - (27%)
Similarity:106/242 - (43%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAIEPRIVGGIKAKQGQFPHQISLRLR-GEHYCGGVIISATHVITAGHCVKHGNDVVPADLWS 92
            |.|:|..||:.|........|.|.:|... ...:|.||::....|::|.||::        |.::
  Rat    24 SASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQ--------DSYT 80

  Fly    93 IQAGSLLLSSDGVRIPVAEV------IMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQLATED 150
            :..|  |.:.:|.:.|.:.:      |.||||..... |||.:::|...:.....|..|.:|::.
  Rat    81 VGLG--LHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQC 143

  Fly   151 P---PNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKN-SGA 211
            |   ..|:   :||||.: :.|.|...|..|.::..|...||.::......:|.|.....: ...
  Rat   144 PTPGDTCL---VSGWGRL-KNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGPDRKDT 204

  Fly   212 CYGDSGGPATYGGKVVGLASLLLG-GGCGR-AAPDGYLRISKVRAWI 256
            |.||||||......:.||.|  :| |.||: ..|..|..:.|...||
  Rat   205 CNGDSGGPIVCNRSLQGLVS--MGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/233 (27%)
Tryp_SPc 37..219 CDD:238113 49/193 (25%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 60/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.