DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG10587

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:289 Identity:79/289 - (27%)
Similarity:120/289 - (41%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQN---------QSESAIEPRIVGGIKAKQGQF-PHQISLRLRGE 59
            |:.:|...|..::| |.||:.|.         ......:.|:|||......|. .:.|:||....
  Fly     6 LYCLLTAPLASIEV-LAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALRYEMN 69

  Fly    60 HYCGGVIISATHVITAGHC----VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYAT 120
            ..|||.::....|:||.||    ||..:       |....|:..|:..|::..|.|||....:..
  Fly    70 FVCGGTLLHDLIVLTAAHCFLGRVKISD-------WLAVGGASKLNDRGIQRQVKEVIKSAEFRE 127

  Fly   121 GGHN-DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWG--NIAEKGPLSDSLLFVQVTS 182
            ...| |:|:|||:.|:. ..::..:.|..:.......:.:||||  ..:|.|| ...|..|.|..
  Fly   128 DDMNMDVAILRLKKPMK-GKSLGQLILCKKQLMPGTELRVSGWGLTENSEFGP-QKLLRTVTVPV 190

  Fly   183 ISRGACR-------WMFYS--------RLPETMIC--LLHSKNSGACYGDSGGPATYGGKVVGLA 230
            :.:..||       |..:.        .|.::|.|  :|..|:  ||..|||||..|..:|.|:.
  Fly   191 VDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKD--ACTFDSGGPLVYKNQVCGIV 253

  Fly   231 SLLLGGGCGRAAPDG-YLRISKVRAWIAE 258
            |  .|.||......| |..|..|:.:|.:
  Fly   254 S--FGIGCASKRYYGVYTDIMYVKPFIEQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/245 (29%)
Tryp_SPc 37..219 CDD:238113 56/206 (27%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 70/245 (29%)
Tryp_SPc 46..280 CDD:238113 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.