DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Sems

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:117/271 - (43%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQS-----------ESAIEPRIVGG---IKAKQGQFPHQISLRLRG 58
            :.|.||.|: :|....:..|::           ..|.:.|::||   ..||.|.:  .:::|...
  Fly     5 LFLFLLAGI-LINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGY--LVAMRYFN 66

  Fly    59 EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH 123
            ...|||.:|....|:||.||.:   |....:.||:..|...||..|:|..|...|....:.....
  Fly    67 NFICGGTLIHELIVLTAAHCFE---DRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTM 128

  Fly   124 N-DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWG--NIAEKGPLSDSLLFVQVTSISR 185
            | |:||:.|..|:. ..||..:.|.:........:|:||||  |..::|| ...|..|.|..|.:
  Fly   129 NMDVAVVLLNRPMV-GKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGP-GHMLRTVSVPVIEK 191

  Fly   186 GACRWMFYS--RLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGC-GRAAPDGYL 247
            ..||..:..  .:.::|.|........||..|||||..|..:|.|:.|  .|.|| .|..|..|.
  Fly   192 RICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVS--FGIGCASRRYPGVYT 254

  Fly   248 RISKVRAWIAE 258
            .:..|:.:|.:
  Fly   255 DVHYVKPFIVK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/228 (30%)
Tryp_SPc 37..219 CDD:238113 55/189 (29%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 69/228 (30%)
Tryp_SPc 44..265 CDD:238113 69/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.