DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Jon74E

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:128/275 - (46%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEH----YCGGVII 67
            |:|:.||..||   |:.::.......|..||.||..|:..|||:|:.|.:...:    :||..:|
  Fly     5 TILVFLLILVQ---GRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLI 66

  Fly    68 SATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDG--VRIPVAEVIMHPNY-ATGGHNDLAVL 129
            |..:::||.|||:....:      :...|.:|..:..  :|....||.:||:: .....||:|::
  Fly    67 SDRYLLTAAHCVEKAVAI------TYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALV 125

  Fly   130 RLQSPLTFDANIAAIQL----ATEDPPNCVAVDISGWGNI-AEKGPLSDSLLFVQVTSISRGACR 189
            ||........:|..|:|    ::.:..:.|....||||.: .|...:||:|.:|.....|...|.
  Fly   126 RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE 190

  Fly   190 WMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLG-------GGCGRAAPDGYL 247
            :. |:.:..|.||:..:.....|.||||||..|...|.. |.:|:|       .||.:..|..:.
  Fly   191 YS-YANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQN-ADILIGVTSYGKKSGCTKGYPSVFT 253

  Fly   248 RISKVRAWIAEKAGL 262
            ||:....||.|.:|:
  Fly   254 RITAYLDWIGEVSGV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/238 (28%)
Tryp_SPc 37..219 CDD:238113 54/193 (28%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.