DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG4914

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:111/272 - (40%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AQNQS---------ESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK 80
            ||||:         |...|.|||||......::|....|......||||.:|:..:|:||.||||
  Fly   107 AQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVK 171

  Fly    81 HGNDVVPADLW---SIQAGSLLLSSDGVRIPVAEVIMH--------PNYATGGHNDLAVLRLQSP 134
                   ..:|   .:..|.....:|..| |....::.        .|:    .||:|:|||...
  Fly   172 -------GFMWFMIKVTFGEHDRCNDKER-PETRFVLRAFSQKFSFSNF----DNDIALLRLNDR 224

  Fly   135 LTFDANIAAIQLATEDPPNCVAVD----ISGWGNIAEKGPLSDSLLFVQVTSISRGAC-RWMFYS 194
            :...:.|..|.|...:....:.|.    .:|||.:.|.|..|..|..|:|..:....| ....|:
  Fly   225 VPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYT 289

  Fly   195 R--LPETMICLLHSKNSG--ACYGDSGGPAT------YGGKVVGLASLLLGGGCGRA-APDGYLR 248
            :  :.:.|:|..:....|  :|.||||||..      ...:.:|:.|  .|.||.|. .|..|.|
  Fly   290 QKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVS--WGNGCARPNYPGVYTR 352

  Fly   249 ISKVRAWIAEKA 260
            ::|...||.|.:
  Fly   353 VTKYLDWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/246 (27%)
Tryp_SPc 37..219 CDD:238113 53/201 (26%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 66/246 (27%)
Tryp_SPc 128..363 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.