DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG4613

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:242 Identity:82/242 - (33%)
Similarity:114/242 - (47%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEH-YCGGVIISATHVITAGHCVKHGNDV--VPADLWSIQAGS 97
            |||||.:.:..::| .|:..:||.. :|||.:|:..:|:||.||| ||.|:  |...|..:...|
  Fly   136 RIVGGTQVRTNKYP-WIAQIIRGTFLFCGGTLINDRYVLTAAHCV-HGMDMRGVSVRLLQLDRSS 198

  Fly    98 LLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD--- 158
            ..|   ||...||....|..| .....:|:|:|||..|         |.|.....|.|:..:   
  Fly   199 THL---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQP---------IPLVDTMRPACLPSNWLQ 251

  Fly   159 --------ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY-SRLPETMICLLHSKNSG--AC 212
                    ::|||...|.|..|..|..|.|..|:...||...| |.:.:||:|..:.|..|  ||
  Fly   252 NFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDAC 316

  Fly   213 YGDSGGPATYGGKVVGLASLL-LGGGCGRA-APDGYLRISKVRAWIA 257
            .||||||.....::..||.:: .|.||.:. ||..|.|:|:...|||
  Fly   317 QGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/239 (33%)
Tryp_SPc 37..219 CDD:238113 66/199 (33%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 79/239 (33%)
Tryp_SPc 137..362 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.