DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG11529

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:244 Identity:70/244 - (28%)
Similarity:108/244 - (44%) Gaps:39/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KAKQG---QFPHQISL----RLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLW----SIQ- 94
            ::|.|   :||:|:.|    ..|....|||.::....::|||||..   .|...|::    |:: 
  Fly    32 QSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTM---GVTHYDVYLGTKSVED 93

  Fly    95 ---AGSLLLSSDGVRIPVAEVIMH----PNYATGGHNDLAVLRLQSPLTFDANIAAIQLAT---E 149
               :|.|:|.|:       :.|:|    |..|.   ||:|:::|...:.|...|....|.:   .
  Fly    94 TEVSGGLVLRSN-------KFIVHERFNPETAA---NDIALVKLPQDVAFTPRIQPASLPSRYRH 148

  Fly   150 DPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYG 214
            |....::|..||||.:.|. ..|||:.:.::..||...|. ..|..:...:||....|:...|.|
  Fly   149 DQFAGMSVVASGWGAMVEM-TNSDSMQYTELKVISNAECA-QEYDVVTSGVICAKGLKDETVCTG 211

  Fly   215 DSGGPATYGGK--VVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAG 261
            |||||......  |||:.|.....||....|.|:.|::....||..|.|
  Fly   212 DSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/237 (28%)
Tryp_SPc 37..219 CDD:238113 55/198 (28%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 66/235 (28%)
Tryp_SPc 37..255 CDD:214473 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.