DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG18180

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:277 Identity:79/277 - (28%)
Similarity:121/277 - (43%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQS---ESAIEPRIVGGIKAKQGQFPHQISLRLRGE-----HYCGGV 65
            ||.|...:.::.......|::   ....|.|||.|..|.:|:.|:.:.|.:|.:     ....|.
  Fly     5 LLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGT 69

  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVA--EVIMHPNYATGGHNDLAV 128
            ||:...::||.||       :..|...|..||....:...|..|.  ..|.||::.:.|..|:.:
  Fly    70 IIANDWILTAAHC-------LTGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGL 127

  Fly   129 LRLQSP-LTFDANIAAIQLATEDPPN-------CVAVDISGWGNIAEKGPLSDSLLFVQVTSISR 185
            :|  :| :.|:..|..|.|.:.:..|       |||   .|||.: :.|.|:|.|..|.|..||.
  Fly   128 IR--TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVA---CGWGGM-DNGNLADWLQCVDVQIISN 186

  Fly   186 GACRWMFYSRLPETMICLLHSKNSGACYGDSGGP-ATY-GGKVVGL---ASLLLGGGCGRAAPDG 245
            ..|. ..|..:..|.:|..|:.....|.|||||| .|: ..::||:   ||:....|     |.|
  Fly   187 SECE-QAYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVSCHDG-----PSG 245

  Fly   246 YLRISKVRAWIAEKAGL 262
            |.|:|....||.::.|:
  Fly   246 YTRVSDYLEWIRDQTGI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/239 (30%)
Tryp_SPc 37..219 CDD:238113 57/196 (29%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 71/239 (30%)
Tryp_SPc 36..259 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27261
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.