DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG3088

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:265 Identity:64/265 - (24%)
Similarity:118/265 - (44%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL-RGEHYCGGVIISATHV 72
            ||::..|:.::.... |:..||.. :..|..|..|.:||.|:.:.:.. :...:|.|.||..|.:
  Fly     3 LLVVFLGLTLVAAGS-AKKDSEDP-DHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWI 65

  Fly    73 ITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTF 137
            :|:..|:...:.|      :|..|:..||.....:.|..    ..|.||..: ||::|:  |...
  Fly    66 LTSAQCLTGSSGV------TIYFGATRLSQAQFTVTVGT----SEYVTGNQH-LALVRV--PRVG 117

  Fly   138 DAN------IAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY--S 194
            .:|      :.:::..::...|..| ::.|||.......|:|:|..|.:..:|...| ..||  :
  Fly   118 FSNRVNRVALPSLRNRSQRYENWWA-NVCGWGVTTFSNGLTDALQCVDLQIMSNNEC-IAFYGST 180

  Fly   195 RLPETMICLLHSKNSGACYGDSGGP--ATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIA 257
            .:.:.::|.........|:||:|.|  ......|||:::.:...||....|.|:.||:....||.
  Fly   181 TVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIH 245

  Fly   258 EKAGL 262
            ::.|:
  Fly   246 QRTGI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 55/230 (24%)
Tryp_SPc 37..219 CDD:238113 45/190 (24%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 57/231 (25%)
Tryp_SPc 29..244 CDD:214473 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.