DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG4477

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:229 Identity:63/229 - (27%)
Similarity:108/229 - (47%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ISLRLRG-------EHYCGGVIISATHVITAGHCVKHGNDV-VPADLWSIQAGSL----LLSSDG 104
            :|||.|.       .|:|.|||::...|:|:.||:.:...| :.:.:..|.||:|    .:.:..
  Fly    55 VSLRSRSAEKFFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRT 119

  Fly   105 VRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDAN---IAAIQLATEDPPNCVAVDISGWGNIA 166
            ...||..:.:..::......|..:|::::|  |..|   |:..:|....|...:...:.|||.:.
  Fly   120 FVTPVTHIWLPDSFTMRNKQDFGLLKVKNP--FPRNNEHISIARLPVHPPLPGLKCKVMGWGRMY 182

  Fly   167 EKGPLSDSLLFVQVTSISRGAC-RWMFYSRLPET-MICLLHSKNSGA---CYGDSGGPATYGGKV 226
            :.|||:..:|::.|..|...|| :|:   |:|.. .:|.:.|.:..|   |.||.|.|..:.|.|
  Fly   183 KGGPLASYMLYIDVQVIDSEACAKWL---RVPSVEHVCAVDSDDLTAQQPCGGDWGAPMLHNGTV 244

  Fly   227 VGLASLLLGGGCGRA-APDGYLRISKVRAWIAEK 259
            .|:.::|  .|||.: .|..|..:.....||.||
  Fly   245 YGIVTIL--AGCGVSHLPSLYTNVHSNANWIHEK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/224 (26%)
Tryp_SPc 37..219 CDD:238113 49/186 (26%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 61/227 (27%)
Tryp_SPc 55..273 CDD:214473 59/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.