DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG16998

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:121/269 - (44%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEP--RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISAT 70
            ::|||:||            ...||:.|  |||||::......|...|:.:.|.:.|...:|::.
  Fly     6 LILLLICG------------HKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSL 58

  Fly    71 HVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSP 134
            .::||||||::      .|.:|::|||......|.|..|..||:||::.... .||:|:|:|...
  Fly    59 WLVTAGHCVQY------PDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKS 117

  Fly   135 LTFDANIAAIQLATED----PPNCVAVDISGWGN----IAEKGPLSDSLLFVQVTSISRGACRWM 191
            .|...||..::|....    |...:   ::||||    .:|..|   .|....|..|::..|: .
  Fly   118 FTLGGNIQVVKLPLPSLNILPRTLL---VAGWGNPDATDSESEP---RLRGTVVKVINQRLCQ-R 175

  Fly   192 FYSRL----PETMICLLHSKNSGA----CYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYL 247
            .||.|    .:.|:|.     :||    ||||||.|..:.|...|:.|  ...||... .|..|.
  Fly   176 LYSHLHRPITDDMVCA-----AGAGRDHCYGDSGAPLVHRGSSYGIVS--FAHGCADPHFPGVYT 233

  Fly   248 RISKVRAWI 256
            |::....||
  Fly   234 RLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/237 (30%)
Tryp_SPc 37..219 CDD:238113 60/198 (30%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 70/237 (30%)
Tryp_SPc 25..242 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.