DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG10469

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:122/282 - (43%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGE------HYCGGVIIS 68
            |:|:....::.||:..        ..||:.|..||..|.|:|:.|....|      :.|||.|:|
  Fly     5 LVLIVQFSLVFGQETG--------SLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILS 61

  Fly    69 ATHVITAGHCVKHGNDVVPADLWS--IQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-------- 123
            ...:|||.||::...    ::||.  |..|.:....|      .|::::.:| |..|        
  Fly    62 NRWIITAAHCLQDPK----SNLWKVLIHVGKVKSFDD------KEIVVNRSY-TIVHKKFDRKTV 115

  Fly   124 -NDLAVLRLQSPLTFDANI--AAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISR 185
             ||:|:::|...|||:..|  |.:..|.:......|: |||||...::.| |..|.:::...||.
  Fly   116 TNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRKAI-ISGWGLTTKQLP-SQVLQYIRAPIISN 178

  Fly   186 GACRWMFYSRL--------PETMICLLHSKNSGACYGDSGGPATY--GGK-VVGLASLLLGGGCG 239
            ..|...:..:|        ....|| :.||....|.||||||...  |.: :||:.|....|.|.
  Fly   179 KECERQWNKQLGGKSKKVVHNGFIC-IDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECK 242

  Fly   240 RAAPDGYLRISKVRAWIAEKAG 261
            ...||...|:|....||...:|
  Fly   243 LKLPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/249 (29%)
Tryp_SPc 37..219 CDD:238113 60/208 (29%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 73/249 (29%)
Tryp_SPc 24..260 CDD:238113 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.