DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG10472

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:287 Identity:82/287 - (28%)
Similarity:128/287 - (44%) Gaps:39/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLL-LLCGVQVI---------LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL---RG 58
            ||||| .:.|.|.:         :...:.:...|:....||.||..|:..|||:|:.|.|   .|
  Fly     7 TVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGG 71

  Fly    59 EHYCGGVIISATHVITAGHC---VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAE---VIMHPN 117
            ..:|||.|||...:|||.||   :..|.||.........|     ..:|.:|...|   ||:|.:
  Fly    72 AAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNA-----KEEGQQIIFVETKNVIVHED 131

  Fly   118 Y-ATGGHNDLAVLRLQSPLTFDANIAAIQL-------ATEDPPNCVAVDISGWGNIAEKGP-LSD 173
            : |....||:::::|..|:.|:..|...:|       :|....|.:|   ||||.|::... .:|
  Fly   132 WIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIA---SGWGKISDSATGATD 193

  Fly   174 SLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATY---GGKVVGLASLLLG 235
            .|.:..|..::...|...::..:..:.||:..:.....|.||||||...   ...::|..|..:.
  Fly   194 ILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIA 258

  Fly   236 GGCGRAAPDGYLRISKVRAWIAEKAGL 262
            .||....|..:.||:....||.||:|:
  Fly   259 LGCEVGWPGVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/240 (29%)
Tryp_SPc 37..219 CDD:238113 59/199 (30%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 69/240 (29%)
Tryp_SPc 47..282 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.