DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:249 Identity:66/249 - (26%)
Similarity:120/249 - (48%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLR----GEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAG 96
            ||.||..|..||||:|:.|.|:    ...:|||.:|.:|.|:||.||......|      ::..|
  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSV------TVYLG 95

  Fly    97 SLLLSSDGV--RIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDAN-IAAIQLATEDPPNC--- 154
            :.:.:|..:  .:..:::|:|..:.:.. .||::::::  |.|..:: |:|::|     |:.   
  Fly    96 ATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKI--PATSSSSRISAVKL-----PSISNS 153

  Fly   155 -------VAVDISGWGNIAE-KGPLSDSLLFVQVTSISRGACRWMF-YSRLPETMICLLHSKNSG 210
                   ||| .||||..:: ...::.:|.:|.:|.|:...|...: .|.:.::.:|:..:....
  Fly   154 YSTFVGDVAV-ASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKS 217

  Fly   211 ACYGDSGGPATY--GGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAGL 262
            .|.||||||...  ..:.:||.|.....||.:..|..:.|::....||....|:
  Fly   218 TCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIKTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/241 (26%)
Tryp_SPc 37..219 CDD:238113 53/201 (26%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 63/241 (26%)
Tryp_SPc 38..268 CDD:238113 64/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.