DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG14990

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:127/310 - (40%) Gaps:68/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WTTLWTVLLLLLCGVQ---------VILGQDVAQNQSESAIEP------------RIVGGIKAKQ 45
            ||....:|:..||...         :..|....:|     ::|            .:|..:|..:
  Fly     5 WTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTEN-----LQPDPNQVCGMSNPNGLVANVKVPK 64

  Fly    46 -----GQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGND---VVPADLWSI-QAGSLLLS 101
                 ||||..::|..:|:::..|.:|:...|:||...|....|   ||.|..|:. |....|.|
  Fly    65 DYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPS 129

  Fly   102 SDGVRIPVAEVIMHPNYA-TGGHNDLAVLRLQSPLTFDANIAAIQLATE----DPPNCVAVDISG 161
            .|.   |||.|:.|..:: ..|.|::|:|.|.:|....::|..|.|.::    |...|:   ::|
  Fly   130 EDR---PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCL---VTG 188

  Fly   162 WGNIA-EKGPLSDSLLFVQVTSISRGACRWMFYSR-------LPETMICLLHSKNSGACYGDSGG 218
            ||.:| .....|:....:::..|:|..|:....:.       ||.::||....|::|.|.||.|.
  Fly   189 WGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGS 253

  Fly   219 ---------PATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAE 258
                     |:.|  :..|:.:  .|.||... .|..|..:...|.||.|
  Fly   254 ALFCPMEADPSRY--EQAGIVN--WGIGCQEENVPAVYTNVEMFRDWIYE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/251 (26%)
Tryp_SPc 37..219 CDD:238113 57/212 (27%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 67/243 (28%)
Tryp_SPc 67..297 CDD:214473 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.