DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and KLK1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:283 Identity:76/283 - (26%)
Similarity:116/283 - (40%) Gaps:52/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGV 65
            ||       .|:||     |...:....:...|:.|||||.:.:|...|.|.:|.......|||:
Human     1 MW-------FLVLC-----LALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGI 53

  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSD---GVRIPVAEVIMHPNYATG---GH- 123
            ::....|:||.||:        :|.:.:..|...|..|   ...:.|:|...||.:...   .| 
Human    54 LVHRQWVLTAAHCI--------SDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHT 110

  Fly   124 --------NDLAVLRLQSPL-TFDANIAAIQLATEDP---PNCVAVDISGWGNI-AEKGPLSDSL 175
                    :||.:|||..|. |....:..::|.||:|   ..|:|   ||||:| .|.....|.|
Human   111 RQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLA---SGWGSIEPENFSFPDDL 172

  Fly   176 LFVQVTSISRGACRWMFYSRLPETMICLLHSK-NSGACYGDSGGPATYGGKVVGLASLLLGGG-- 237
            ..|.:..:....|:.....::.:.|:|:.|.: ....|.||||||....|.:.|:.|    .|  
Human   173 QCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTS----WGYV 233

  Fly   238 -CGRA-APDGYLRISKVRAWIAE 258
             ||.. .|...:|:.....||.:
Human   234 PCGTPNKPSVAVRVLSYVKWIED 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/244 (27%)
Tryp_SPc 37..219 CDD:238113 56/202 (28%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.