DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG3650

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:266 Identity:87/266 - (32%)
Similarity:131/266 - (49%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGG----IKAKQGQFPHQISLRLRGEHYCGGV 65
            :|..|.||.. .|::||  :|..|    |:||||||    :.|..|   ..::||..|..||||.
  Fly     1 MWRPLFLLQL-TQLLLG--LASGQ----IQPRIVGGTTTTLSAVGG---FVVNLRYDGTFYCGGS 55

  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVL 129
            :::::||:||.||:|.    ..|...::|.|...||..||...||...:...:::...| |:.|:
  Fly    56 LVTSSHVVTAAHCLKG----YQASRITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVI 116

  Fly   130 RLQSPLTFDANIAAIQLATE--DPPNCVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGACRW 190
            ||||.|| .:.|..|.|...  :|.|.:.|  ||||  ......| |:.|..|::..|.:..|:.
  Fly   117 RLQSALT-GSGITTIPLCQVQWNPGNYMRV--SGWGTTRYGNSSP-SNQLRTVRIQLIRKKVCQR 177

  Fly   191 MFYSR--LPETMICLLHSKNSG--ACYGDSGGPATYGGKVVGLASLLLGGGCGRAA-PDGYLRIS 250
            .:..|  |..:..|   ::..|  :|.|||||...:..::.|:.|  .|.||..|. |..|..:.
  Fly   178 AYQGRDTLTASTFC---ARTGGKDSCSGDSGGGVIFKNQLCGIVS--WGLGCANAQYPGVYTSVH 237

  Fly   251 KVRAWI 256
            :||::|
  Fly   238 RVRSFI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/233 (32%)
Tryp_SPc 37..219 CDD:238113 63/194 (32%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 75/233 (32%)
Tryp_SPc 26..243 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.