DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG15873

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:118/289 - (40%) Gaps:65/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLLCGVQV------ILGQDVAQNQSESAIEPRIVGGIKAKQGQFP-HQISLRL------RG 58
            ||.|.|:....:      ::| |:    |:...|..|.||.|.|..:.. |.:|:|.      ||
  Fly     5 TVFLGLILSTSLSDADLGVIG-DI----SDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRG 64

  Fly    59 E-HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRI--------------- 107
            : |:|.||::|:..|:||.||:        .|.:...     ::..|:|:               
  Fly    65 DNHFCSGVLVSSRAVLTAAHCL--------TDRYKAS-----MNPRGIRVVFGHITRLAVYDESD 116

  Fly   108 --PVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPN------CVAVDISGWGN 164
              .|..:::||.|.....||||:||| |.....:|...:.|......|      |:.:   |||.
  Fly   117 FRSVDRLVVHPEYERYKKNDLAILRL-SERVQSSNHDVLPLLMRKTANVTYGDTCITL---GWGQ 177

  Fly   165 IAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGL 229
            |.:.||.|:.|:::.|.......|:..:.:...:..:|......|..|.||.|||....|.:.| 
  Fly   178 IYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKGALFG- 241

  Fly   230 ASLLLGG--GCGRAAPDGYLRISKVRAWI 256
               |:||  ||.......:|.....:.||
  Fly   242 ---LIGGHMGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 65/252 (26%)
Tryp_SPc 37..219 CDD:238113 55/212 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 63/234 (27%)
Tryp_SPc 59..250 CDD:238113 55/211 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.