DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG13430

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:88/266 - (33%)
Similarity:129/266 - (48%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHV 72
            |.|.|:|       ...|||.::...:.|||||.:.....||||:||:|...|.|||.|||...:
  Fly    10 VALWLIC-------TSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNII 67

  Fly    73 ITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY--ATGGHNDLAVLRLQSPL 135
            :||.|||.   :......:.|:|||...:..|..|.|.::|.||.:  .|..:||:|:::||.||
  Fly    68 LTAAHCVL---EYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPL 129

  Fly   136 TFDANIAAIQLATEDP---PNCVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGACRWMFY-- 193
            .:..:|..|.|||...   |. ..:.:||||  :|::..| ...|.:..|....:..|...::  
  Fly   130 VYSQDIRPISLATSKDIIMPT-AQLFVSGWGSTSISQMQP-EKRLRYTVVHLRDQNQCARNYFGA 192

  Fly   194 SRLPETMICL-LHSKNSGACYGDSGGP--ATYGG--KVVGLASLLLGGGCGRAA-PDGYLRISKV 252
            ..:..||.|. ..:....:|.||||||  .:..|  |:.|:.|  .|.||..|. |..|.::|..
  Fly   193 GTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVS--WGFGCANAMFPGIYTKVSAY 255

  Fly   253 RAWIAE 258
            ..|||:
  Fly   256 DDWIAQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/234 (33%)
Tryp_SPc 37..219 CDD:238113 64/191 (34%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 78/234 (33%)
Tryp_SPc 32..262 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.