DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG9897

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:251 Identity:62/251 - (24%)
Similarity:100/251 - (39%) Gaps:39/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            :.||:.|........|...|:.:..:..|||.|||..:::||..||    |...|....::.|:.
  Fly    20 DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCV----DGYSARSIQVRLGTS 80

  Fly    99 LLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGW 162
            ...:.|....:.:|.:|..|::.. .|:||:|:....|.....|..|:.|.:.|.:....:::|.
  Fly    81 SCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDEIKPIERADKVPDDNSRANVTGC 145

  Fly   163 GNIAEKGPLSDSLLFVQVTS--------------------ISRGACR--WM---FY--SRLPETM 200
            |  ...|...|.:|.::::|                    :|:..|.  |.   ||  ..:.:..
  Fly   146 G--GRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISDLT 208

  Fly   201 ICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            || ..|...|||..|.|.|.....|:||:.|   ..||. ..||.|..|.....|:
  Fly   209 IC-TKSPGKGACSTDRGSPLVIDNKLVGILS---RAGCS-IKPDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/247 (25%)
Tryp_SPc 37..219 CDD:238113 49/209 (23%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.