DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG32833

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:105/255 - (41%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHG--N 83
            |:| ::...|:......:||........|...|:.::.:..|.|.|...:|::|||.|| .|  |
  Fly    23 GED-SEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCV-DGFLN 85

  Fly    84 DVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYA--TGGHNDLAVLRLQSPLTFDANIAAIQL 146
            .|:     .::.||...|...:.:.|..:.:|..:.  |..|| :|:|:|..||.....|..|||
  Fly    86 KVI-----RVRVGSTTRSDGVIEVAVCNITVHEKFTGQTVFHN-VAILKLCEPLEASKTIQPIQL 144

  Fly   147 ATEDPPNCVAVDISGWGN-----IAEKGPLSD---SLLFVQVTSISRGAC-------RWMFYSRL 196
            |.:.|.|...|..:||.:     :..|..|.|   .|...:|..:....|       .|. ....
  Fly   145 ANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWS-KKNF 208

  Fly   197 PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            .:.:.| .......||....|.|..:.||:||   ::..|||.. .|:.|:.:.|.:.|:
  Fly   209 TDDLFC-TEKFAKEACSLAMGSPVVHNGKLVG---IITKGGCSE-YPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/238 (26%)
Tryp_SPc 37..219 CDD:238113 50/200 (25%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 62/237 (26%)
Tryp_SPc 40..262 CDD:214473 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.