DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG13527

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:117/265 - (44%) Gaps:23/265 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLR-------GEHYCGGVIISA 69
            :|..|.|||.   ..::.:....|:..|....:..::  .:|:|.|       ..|||||.::|.
  Fly    10 ILITVMVILS---GAHRMKRLSSPKFHGDETLELAKY--VVSIRSRTPNKYFGDNHYCGGGLLSN 69

  Fly    70 THVITAGHCVKHGNDVVPADLW-SIQAGS--LLLSSDGVRI--PVAEVIMHPNYATGGHNDLAVL 129
            ..||||.|||...:.::....| .:.|||  .|..:.|..:  ||:.:.:..|:......::|::
  Fly    70 QWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALM 134

  Fly   130 RLQSPL-TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY 193
            :||..: :.|..|..:.|..|.|...:...:.|||.:...|||:..:..|.|..:....|: .::
  Fly   135 KLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCK-TYF 198

  Fly   194 SRLPETMICLLHSK---NSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAW 255
            ....:.|:|..::.   ::..|.||.|.|...|..|||:.:..:|.||.. .|..|..:.....|
  Fly   199 RHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTN-IPSVYTDVFSGLRW 262

  Fly   256 IAEKA 260
            |...|
  Fly   263 IRHTA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/235 (25%)
Tryp_SPc 37..219 CDD:238113 49/197 (25%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/226 (27%)
Tryp_SPc 43..263 CDD:214473 58/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.