DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG10764

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:92/233 - (39%) Gaps:50/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIE--------PRIVGGIKAKQGQFPHQISLRLRGEHYCGGVI 66
            ||.||         |.:|:....:|        |:|.||..|.:.......::....:..|||.|
  Fly    12 LLTLC---------VTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTI 67

  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLR 130
            |....|::|.||:..|.|:.      ::.|:..::.......|..|.:|.:: |:...||:.:|:
  Fly    68 IHMRFVLSAAHCLVRGYDLY------VRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQ 126

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVDIS--------------GWGNIAEKGPLSDSLLFVQVT 181
            |...:.:...:         .|.|:.:|.:              ||||  ..|.||..|..:.:.
  Fly   127 LSESIVYTVRV---------QPICIFLDPALKGSVEKLKTFRALGWGN--RNGKLSIMLQTIYLL 180

  Fly   182 SISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGP 219
            .:.|..|:......|....|| ..:||...|.||||||
  Fly   181 HLKRNECKRKLNFNLNSRQIC-AGTKNGDTCRGDSGGP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 49/199 (25%)
Tryp_SPc 37..219 CDD:238113 47/196 (24%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 49/199 (25%)
Tryp_SPc 38..263 CDD:238113 49/198 (25%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.