DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG8299

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:264 Identity:86/264 - (32%)
Similarity:129/264 - (48%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGE---HYCGGVIISATH 71
            |.||..:.|::..|.|      :|...||||.:|....||:|:|:||...   |.|||.|.:...
  Fly     7 LFLLAALGVVILTDSA------SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65

  Fly    72 VITAGHCVKHGNDVVPADLWSIQAG--SLL-LSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQ 132
            ||||.||:|...    |....|.||  |:. |...||:  |:::|.|..|....: ||:.::..:
  Fly    66 VITAAHCIKGRY----ASYIRIVAGQNSIADLEEQGVK--VSKLIPHAGYNKKTYVNDIGLIITR 124

  Fly   133 SPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSR- 195
            .||.:.|.:..|.:|.|.||:.....:||||..||......::| .|::..|.:..|...:.:: 
  Fly   125 EPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKD 189

  Fly   196 --LPETMICLLHSK-NSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
              :.:.|:|..:.: ....|.||||||....|.:||:.|  .|.||||.. |..|..::....||
  Fly   190 YTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVS--WGVGCGREGFPGVYTSVNSHIDWI 252

  Fly   257 AEKA 260
            .|:|
  Fly   253 EEQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/232 (32%)
Tryp_SPc 37..219 CDD:238113 62/193 (32%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 75/232 (32%)
Tryp_SPc 28..255 CDD:238113 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.