DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Ctrc

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:254 Identity:75/254 - (29%)
Similarity:116/254 - (45%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISLR-LRGE---HYCGGVIISATHVITAGHCVKHGNDVVPADLWSI 93
            :..|:|||..|....:|.|:||: |:.:   |.|||.:|:.:||:||.||:  ..|..    :.:
  Rat    26 LSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVLTAAHCI--NKDFT----YRV 84

  Fly    94 QAGSLLLSSD----GVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSP--LTFDANIAAI----QLA 147
            ..|...|:.:    .|...|..:.:|..: .....||:|:::|..|  |:....:|.|    .|.
  Rat    85 GLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLL 149

  Fly   148 TEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACR---WMFYSRLPETMICLLHSKNS 209
            .:|.| |.   ::|||.:...||:::.|.......:|...|.   |.|. ::.:||:|.......
  Rat   150 PQDYP-CY---VTGWGRLWTNGPIAEVLQQGLQPIVSHATCSRLDWWFI-KVRKTMVCAGGDGVI 209

  Fly   210 GACYGDSGGP----ATYGG-KVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAEKAGL 262
            .||.||||||    |..|. :|.|:.|.....||. ...|..:.|:|....||.||..|
  Rat   210 SACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVSAYNDWINEKIQL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/243 (29%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 70/243 (29%)
Tryp_SPc 30..265 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.