DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and gammaTry

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:257 Identity:93/257 - (36%)
Similarity:132/257 - (51%) Gaps:14/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            ::||..|...||..|.:..... ::.|||||.......||.||||:..|.|.|||.|.|:..::|
  Fly     5 VILLSAVACALGGTVPEGLLPQ-LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68

  Fly    75 AGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFD 138
            |.||::.    |.|.:..|:|||...||.||...|:....|..| |....||:|::::...|||.
  Fly    69 AAHCLQS----VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129

  Fly   139 ANIAAIQLATEDPPNCVAVDISGWGNIA-EKGPLSDSLLFVQVTSISRGACRWMFY---SRLPET 199
            :.|.||.||:.:|.|..|..:||||.:: ....:...|.:|.|..:|:..|....|   |::..|
  Fly   130 STIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194

  Fly   200 MICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEKA 260
            |||...| ...||.||||||...||.:||:.|  .|.||..: .|..|..::.:|:|:...|
  Fly   195 MICAAAS-GKDACQGDSGGPLVSGGVLVGVVS--WGYGCAYSNYPGVYADVAALRSWVISNA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 85/225 (38%)
Tryp_SPc 37..219 CDD:238113 71/186 (38%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.