DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and thetaTry

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:79/257 - (30%)
Similarity:119/257 - (46%) Gaps:15/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLR-GEHYCGGVIISATH 71
            |||:.|.......|.....|......|.|||||.....|..|:|:||:.: |.|:|||.:|:...
  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDT 70

  Fly    72 VITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPL 135
            |:||.||:. |..|...   .::.||.|.:..|:.:.|.|:..:.:| :.....|:.:|:|...:
  Fly    71 VVTAAHCLV-GRKVSKV---FVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKV 131

  Fly   136 TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKG--PLSDSLLFVQVTSISRGAC---RWMFYSR 195
            ....||..|:||||.||......::|||:.....  .|..:|..|.|..:....|   .:.:...
  Fly   132 KETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEI 196

  Fly   196 LPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGC-GRAAPDGYLRISKVRAWI 256
            :.::|:| .:.|...||.||||||...|..:||:.|  .|..| ....|..|..:..:|.||
  Fly   197 IYDSMVC-AYEKKKDACQGDSGGPLAVGNTLVGIVS--WGYACASNLLPGVYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/227 (31%)
Tryp_SPc 37..219 CDD:238113 58/188 (31%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 70/227 (31%)
Tryp_SPc 35..255 CDD:238113 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.