DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG12133

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:270 Identity:73/270 - (27%)
Similarity:113/270 - (41%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISL-------RLRGEHYCGGVIISATHVITAGHCV-------------KH 81
            ||||::|:..|||..:.|       :.|....|.|.:|::.:|:||.||:             :|
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126

  Fly    82 GNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYAT--GGH-NDLAVLRLQSPLTFDANI-- 141
            ..:..|...| :..|:.:.:...|.|.|...:.|..|.|  |.| ||:|:|||:|.:.:...|  
  Fly   127 DTENDPDYTW-LPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRP 190

  Fly   142 ----AAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQ--VTSISRGACRWMFYSRLP--- 197
                ..|:|:|....| ....|:|||   :.|....|.:..|  ::.:|...|    .:|.|   
  Fly   191 ICIWPGIELSTSSFKN-FPFQIAGWG---DSGLQQKSTVLRQGTISGMSPDEC----LNRYPTLL 247

  Fly   198 ---ETMICLLHSKNSGACYGDSGGP--ATYGG------KVVGLASLLLGGGCGR--AAPDGYLRI 249
               :..||.:....:....||||.|  |:.|.      .:.|:.|  .|||...  ..|..|.:.
  Fly   248 VDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITS--YGGGPSSYGYGPAVYTKT 310

  Fly   250 SKVRAWIAEK 259
            |....||.:|
  Fly   311 SSYYEWIKKK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/265 (26%)
Tryp_SPc 37..219 CDD:238113 59/218 (27%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 72/268 (27%)
Tryp_SPc 62..317 CDD:214473 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.