DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and PRSS41

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:277 Identity:85/277 - (30%)
Similarity:130/277 - (46%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AQNQSES---------AIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV- 79
            |::|.|.         .|...:.||:::.:|::|.|.|||||..|.|||.::|...|::|.||. 
Human    50 AESQEEELLSEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQ 114

  Fly    80 KHGNDVVPADLWSIQAGSLL-------LSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTF 137
            ||   ..|:: |::|.|.|.       |.:...|..|.::|::|:......||:|:|||.|.:|:
Human   115 KH---YYPSE-WTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTY 175

  Fly   138 DANIAAIQLATE-----DPPNCVAVDISGWGNIAEKG---PLSDSLLFVQVTSISRGACRWMF-- 192
            :|.|..|.:.:.     ..|:|.   ::|||.|:..|   |...:|...|||.::...|.::|  
Human   176 NAYIQPICIESSTFNFVHRPDCW---VTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQ 237

  Fly   193 ---YSRLPETMICLLHSKNSGA-------CYGDSGGPAT-------YGGKVVGLASLLLGGGCGR 240
               .|.:.::|.|      :||       |.||||||..       |   .||:.|  .|..||:
Human   238 PSSRSMIWDSMFC------AGAEDGSVDTCKGDSGGPLVCDKDGLWY---QVGIVS--WGMDCGQ 291

  Fly   241 A-APDGYLRISKVRAWI 256
            . .|..|..||....||
Human   292 PNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/255 (31%)
Tryp_SPc 37..219 CDD:238113 66/209 (32%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.