DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:262 Identity:89/262 - (33%)
Similarity:127/262 - (48%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQDVAQNQSESAIEP------RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV 79
            |.|.|  ..|..::|      |||||::|..|:||.|.|||...||:||..||:|..:::|.||.
Human   217 GSDEA--HCECGLQPAWRMAGRIVGGMEASPGEFPWQASLRENKEHFCGAAIINARWLVSAAHCF 279

  Fly    80 KHGNDVVPADLWSIQAGSLLLS---SDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDAN 140
               |:......|....|:..||   :..||..|.:::.||.| |.....|:|||.|.|||.|..:
Human   280 ---NEFQDPTKWVAYVGATYLSGSEASTVRAQVVQIVKHPLYNADTADFDVAVLELTSPLPFGRH 341

  Fly   141 IAAIQLATED---PPN--CVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSRLPET 199
            |..:.|....   ||:  |:   |||||.:.|...:...:| ...|..:.:..|..::...|.:.
Human   342 IQPVCLPAATHIFPPSKKCL---ISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYGHSLTDR 403

  Fly   200 MIC--LLHSKNSGACYGDSGGPATY---GGK--VVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            |:|  .|..| ..:|.||||||...   .|:  :.|:.|  .|.||..| .|..|.|::::|.||
Human   404 MVCAGYLDGK-VDSCQGDSGGPLVCEEPSGRFFLAGIVS--WGIGCAEARRPGVYARVTRLRDWI 465

  Fly   257 AE 258
            .|
Human   466 LE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 81/237 (34%)
Tryp_SPc 37..219 CDD:238113 67/193 (35%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.