DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG13744

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:274 Identity:84/274 - (30%)
Similarity:122/274 - (44%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC 78
            |||     ...|||    .::.||:||..|:..::|.|..:|: .|:.||||:|||..|.||.||
  Fly   128 CGV-----PRTAQN----TLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHC 182

  Fly    79 VKHGNDVVPADLWSIQAGSLLLSSDG-VRIP-------VAEVIMHPNY----ATGGHNDLAVLRL 131
            ::..:   .||: ::..|.|.....| :..|       |.:.|:||.:    ......|:|:|:|
  Fly   183 IQQAH---LADI-TVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKL 243

  Fly   132 QSPLTFDANIAAIQLATEDPPNCVAVD--ISGWGNI-AEKGPLSDSLLFVQVTSI----SRGACR 189
            ..|.:|..:|..|.| .:.|...:...  |:|||.. |..|....::|  ||.|:    :....|
  Fly   244 AQPTSFTEHILPICL-PQYPIRLIGRKGLIAGWGKTEAHMGHAGTNML--QVASVPIITTLDCIR 305

  Fly   190 W----MFYSRLPETMICLLHSK-NSGACYGDSGGPATYGGK----VVGLASLLLGGGCG-RAAPD 244
            |    .....:...|.|..||. :..||.||||||.....:    :||:.|  .|.||| ...|.
  Fly   306 WHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITS--AGFGCGVDHQPG 368

  Fly   245 GYLRISKVRAWIAE 258
            .|..:.|...||.|
  Fly   369 IYHNVQKTVRWIQE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/248 (30%)
Tryp_SPc 37..219 CDD:238113 62/205 (30%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 75/248 (30%)
Tryp_SPc 142..383 CDD:238113 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.