DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Np

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:248 Identity:84/248 - (33%)
Similarity:114/248 - (45%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGE----HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQ 94
            |||||||..|..|::|.|||||....    |.||..:::....|||.|||   ::|.|:|| .::
  Fly   795 EPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCV---DNVPPSDL-LLR 855

  Fly    95 AGSLLLSSDGV-------RIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDP 151
            .|...|:.:..       |:.:  |..||.:...... |||:||...|:.|..||..:.:...| 
  Fly   856 LGEYDLAEEEEPYGYQERRVQI--VASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDND- 917

  Fly   152 PNCV--AVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYS-----RLPETMICLLHSKNS 209
            .|.:  ...::|||.:.|.|||...|..|.|..|:...|..|:.|     .:|...||....|..
  Fly   918 ENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGG 982

  Fly   210 -GACYGDSGGPATY---GGKVVGLASLLLGG-GCGRA-APDGYLRISKVRAWI 256
             .:|.||||||...   ..|...|..::..| ||..| .|..|.|||:.|.||
  Fly   983 YDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 80/244 (33%)
Tryp_SPc 37..219 CDD:238113 65/201 (32%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 80/244 (33%)
Tryp_SPc 798..1038 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.