DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and flz

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:270 Identity:82/270 - (30%)
Similarity:123/270 - (45%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAIEP-----RIVGGIKAKQGQFPHQISLR------LRGEHYCGGVIISATHVITAGHCVKHG 82
            :|..:.|     |||||..:..|.:|.|:.:|      |..::.||||:|::.:||||.||    
  Fly  1436 TECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC---- 1496

  Fly    83 NDVVPADLWSIQA--GSLLLSSD-----GVRIPVAEVIMHPNY--ATGGHNDLAVLRLQSPLTFD 138
               .|..|.|:.|  |...:|.|     .|...|..||:|..|  || ..||||:|.|.||:.||
  Fly  1497 ---QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPAT-FENDLALLELDSPVQFD 1557

  Fly   139 ANIAAIQLATEDPPNCVA------VDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYS--- 194
            .:|..|.:     ||.||      ..::|||.:...|.:...|..|||..|....|:.||::   
  Fly  1558 THIVPICM-----PNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGH 1617

  Fly   195 --RLPETMICLLHSK-NSGACYGDSGGPATY---GGKVVGLASLLLGGGCGRA-APDGYLRISKV 252
              ::..:.:|..::. ...:|.||||||...   .|:.....::..|..|... .|..|:|.:..
  Fly  1618 NKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFY 1682

  Fly   253 RAWIAEKAGL 262
            :.|:....|:
  Fly  1683 KPWLRSITGV 1692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/250 (31%)
Tryp_SPc 37..219 CDD:238113 69/208 (33%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 78/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.