DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG18563

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:259 Identity:55/259 - (21%)
Similarity:106/259 - (40%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVP 87
            |.||.:.....|....||.....|.:...::|.....:..||.:||...::||.|   :..:.:.
  Fly   120 DGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAH---NTMNKMN 181

  Fly    88 ADLWSIQAGSLLLSSDGVRIP-----VAEVIMHPNYA-TGGHNDLAVLRLQSPLTFDANIAAIQL 146
            .|...::||..::::....|.     |..::.|..:. ..|.|::|::.:::|...:..|..:.|
  Fly   182 EDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTL 246

  Fly   147 ----ATEDPPNCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSR-------LPET 199
                |:.:...|.   ::||..::........:: .:::|.:.|..|...|.:.       |..:
  Fly   247 PSRQASFEGRRCT---VAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPS 308

  Fly   200 MICLLHSKNSGACYGDSGGPATY------GGKVVGLASLLLGG-GCGRAAPDGYLRISKVRAWI 256
            :||.....|...|:| .||.|.:      ...|...|.::..| |||...|..|..::..|:||
  Fly   309 LICARSEINRDFCFG-GGGYALFCSLGDENPHVFEQAGIVAWGMGCGLDLPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 49/244 (20%)
Tryp_SPc 37..219 CDD:238113 38/199 (19%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 48/232 (21%)
Tryp_SPc 147..371 CDD:214473 46/230 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.