DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and SPH93

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:113/253 - (44%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGI---KAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV--KHGNDVVPADLWSIQA 95
            ::|.||   :|:..|:|..:::...|::..||.:|....|:|..|.|  .....||.|..|.:::
  Fly   242 QMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLKS 306

  Fly    96 GSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPN------ 153
            ...:..|:  :..|...::|..: ...|.|:||:|.|.||...:.:|..|.|.|   ||      
  Fly   307 DREIFLSE--QREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPT---PNKSFAGR 366

  Fly   154 -CVAVDISGWGNIA-EKGPLSDSLLFVQVTSISRGACRWMFYS-------RLPETMICLLHSKNS 209
             |.   ::|||.:. |....|..|..||:..::|..|.....|       .||:.:||.......
  Fly   367 RCT---VAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGR 428

  Fly   210 GACYGDSGGPATY---GGKVVGL---ASLL-LGGGCGR-AAPDGYLRISKVRAWIAEK 259
            ..|.|| ||.|.:   ||:..|:   |.:: .|.|||: ..|..|..:||...||.||
  Fly   429 DTCTGD-GGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/248 (28%)
Tryp_SPc 37..219 CDD:238113 55/202 (27%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 68/243 (28%)
Tryp_SPc 252..482 CDD:214473 66/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.