DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Send2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:227 Identity:76/227 - (33%)
Similarity:107/227 - (47%) Gaps:29/227 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            |.||:||......:.|.|:|::..|:|.|||.|.||..:|||.|||:       ...:.::|||.
  Fly    24 EERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQ-------GQGYQVRAGSA 81

  Fly    99 LLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLA-TEDPPNCVAVDISGW 162
            |.:|:|..:.||.:..|    .|..||:|::||..||.|...:..|.|| |..||..:|. :|||
  Fly    82 LKNSNGSVVDVAAIRTH----EGLGNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAF-VSGW 141

  Fly   163 GN---IAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGG 224
            |:   .:....|....|::|          |.:|..|.|.......|....||.||||||..:..
  Fly   142 GSSSYYSHPIDLQGVNLYIQ----------WPYYCGLTEPSRICAGSFGRAACKGDSGGPLVFDQ 196

  Fly   225 KVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ::||:.|   ||.........|..:...|.||
  Fly   197 QLVGVVS---GGTKDCTYSSIYTSVPYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/223 (33%)
Tryp_SPc 37..219 CDD:238113 63/185 (34%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 73/223 (33%)
Tryp_SPc 27..225 CDD:238113 72/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.