DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Phae1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:271 Identity:74/271 - (27%)
Similarity:125/271 - (46%) Gaps:44/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            ||||.|:..|.|..:      .|.|.|:|||..|.....|:.:|::..|.|||...|::|..::|
  Fly    15 LLLLLGICRISGVAI------GAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVT 73

  Fly    75 AGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRI-----PVAEVIMHPNYATGG--HNDLAVLRLQ 132
            |.||:.:.|.|:.:   ::.|||:.:  ||...     .:...:::..| |||  ..|:.::...
  Fly    74 AAHCLTNSNQVLGS---TLVAGSIAV--DGTASTTQTRSITYFVINDLY-TGGTVPYDIGMIYTP 132

  Fly   133 SPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLS-DSLLFV--QVTSISRGACRWMFYS 194
            :...:.|.:|.:.|.:.........::.|||:.:.....| .|.|.|  .|..||..:|.....:
  Fly   133 TAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGT 197

  Fly   195 RLPETMICLLHSKN------SGA---CYGDSGGPATYGGKVVGLASLLLGGG---CGRA-APDGY 246
            :..:     :||.|      :|.   |..|||||...|..::|:.|    .|   ||:| :|..|
  Fly   198 KGSD-----VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVS----WGKLPCGQANSPSVY 253

  Fly   247 LRISKVRAWIA 257
            :::|...:||:
  Fly   254 VQVSSFISWIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/242 (26%)
Tryp_SPc 37..219 CDD:238113 50/200 (25%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 63/242 (26%)
Tryp_SPc 36..266 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.