DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG5390

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:271 Identity:75/271 - (27%)
Similarity:113/271 - (41%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QSESAIEPRIVGGI--KAKQGQFPHQISLRLRGE-----HYCGGVIISATHVITAGHCVKH---G 82
            |:.:.:..:|.|.:  :|:.|:||..::: ||.|     :.|||.:|:...|:||.|||.:   .
  Fly   138 QNPNGVGFKITGAVNQEAEFGEFPWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPS 201

  Fly    83 NDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQL 146
            :.||.|..|..|..:.:...:...  |.|:|.|..:..|. :||:||:.|:||.|...||..:.|
  Fly   202 SIVVRAGEWDTQTQTEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL 264

  Fly   147 ATEDPPN---------CVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPET- 199
                 ||         |.|   :|||  ...:.|.....|..|.:..:....|.    :.|.|| 
  Fly   265 -----PNVGDKFDFDRCYA---TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE----TNLRETR 317

  Fly   200 ----------MICLLHSKNSGACYGDSGGP-----ATYGGKVVGLASLLLGGGCGRA-APDGYLR 248
                      .||....|:...|.||.|.|     |....:......:..|.|||.. .|..|..
  Fly   318 LGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYAS 382

  Fly   249 ISKVRAWIAEK 259
            ::|:|.||..|
  Fly   383 VAKLRPWIDAK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/258 (28%)
Tryp_SPc 37..219 CDD:238113 61/214 (29%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/252 (28%)
Tryp_SPc 153..390 CDD:214473 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.