DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and PRSS38

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:285 Identity:79/285 - (27%)
Similarity:138/285 - (48%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVA-------QNQSES----------AIEPRIVGGIKAKQGQFPHQISLR 55
            :|||||    |:....||       :||..|          ::|.:|:||:.|.:.::|.|:|:.
Human    18 LLLLLL----VVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSVH 78

  Fly    56 LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVR-IPVAEVIMHPNY- 118
            ..|.|.|||.|::...|::|.||.....::...|:: :...:|.::.:..: ..|..||:||.| 
Human    79 YAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMY-VGLVNLRVAGNHTQWYEVNRVILHPTYE 142

  Fly   119 ---ATGGHNDLAVLRLQSPLTFDANIAAIQLATED----PPNCVAVDISGWGNIAEKGPLSDSLL 176
               ..||  |:|:::|::.:.|..::..:.|||.:    ..||.|   :|||.::::|..||.|.
Human   143 MYHPIGG--DVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWA---TGWGLVSKQGETSDELQ 202

  Fly   177 FVQVTSISRGACRWMF--YSRLPETMIC---LLHSKNSGACYGDSGGP--ATYGGKVVGLASLLL 234
            .:|:..|....|..::  .|.:...|:|   :|::|.  .|.||||||  ..:....:.:..:..
Human   203 EMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKT--VCEGDSGGPLVCEFNRSWLQIGIVSW 265

  Fly   235 GGGCGRAA-PDGYLRISKVRAWIAE 258
            |.||.... |..|..:|....||.:
Human   266 GRGCSNPLYPGVYASVSYFSKWICD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 65/236 (28%)
Tryp_SPc 37..219 CDD:238113 57/195 (29%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.