DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and PRSS53

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:332 Identity:78/332 - (23%)
Similarity:118/332 - (35%) Gaps:129/332 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVIL-GQDVAQNQSESAIEPRIVGGIKAKQ-----GQFPHQISLRLRGEHYCGGVIIS 68
            :||:.|..|:: |...||.    |...|..|..|.::     |::|.|.|:|.:|.|.|.|.:::
Human     8 VLLIAGATVLMEGLQAAQR----ACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHICSGSLVA 68

  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSLL---LSSDGVRIPVAEVIM---HPNYATGGHNDLA 127
            .|.|:||.||.:.. .....:.||:..|||.   ||.....:.||.:.:   :.:|:.|  :|||
Human    69 DTWVLTAAHCFEKA-AATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQG--SDLA 130

  Fly   128 VLRLQSPLT--------------FDANIAA-----------------------IQLATEDPPNC- 154
            :|:|..|.|              |.|:..|                       :...|...||| 
Human   131 LLQLAHPTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCP 195

  Fly   155 --------------VAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLH 205
                          .|..:|         |...:|..:::..|||..|. ..|::|.:.     |
Human   196 GFQSPLLPRSQTLAPAPSLS---------PAPGTLRNLRLRLISRPTCN-CIYNQLHQR-----H 245

  Fly   206 SKN---------------SGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAW 255
            ..|               .|.|.||||||..                |  ..|||:        |
Human   246 LSNPARPGMLCGGPQPGVQGPCQGDSGGPVL----------------C--LEPDGH--------W 284

  Fly   256 IAEKAGL 262
            :  :||:
Human   285 V--QAGI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/297 (23%)
Tryp_SPc 37..219 CDD:238113 60/259 (23%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 67/294 (23%)
Tryp_SPc 43..314 CDD:214473 67/293 (23%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.