DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:241 Identity:67/241 - (27%)
Similarity:106/241 - (43%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVP--ADLWSIQA 95
            ||.||..|..|.:|:.|:.:.|...|..:|||.||:...|:||.||:.....|:.  ...|...|
  Fly    33 IEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNA 97

  Fly    96 GSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLAT-EDPPN------ 153
                        .....:.:.|:....:.|:|::|:.. :.|...:..::|.: .|..|      
  Fly    98 ------------QFTHTVGNGNFIKHSNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWW 149

  Fly   154 CVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGG 218
            .||   .|||...:..||.|.|..|.:..:....|.|. |..:.:.:||.........|.|||||
  Fly   150 AVA---CGWGGTYDGSPLPDWLQCVDLQIVHNEECGWT-YGSVGDNVICTRTVDGKSICGGDSGG 210

  Fly   219 P-ATY-GGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAGL 262
            | .|: |.|:||:::.:...||...||.|:.|::....||.:..|:
  Fly   211 PLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTGI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/230 (27%)
Tryp_SPc 37..219 CDD:238113 48/190 (25%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 62/230 (27%)
Tryp_SPc 37..253 CDD:238113 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.