DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG3355

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:308 Identity:98/308 - (31%)
Similarity:137/308 - (44%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQ------------------DVAQ--NQSESAIEP-------------- 35
            ::..|.|||.|:.:.|.|                  ||..  .||..|:.|              
  Fly     3 VYLALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCF 67

  Fly    36 -------RIVGGIKAKQGQFPHQISLRLRGEHY----CGGVIISATHVITAGHCVKHGN-DVVPA 88
                   |||||.:.:..::|....| ::|.||    |||.:|:..:|:||.||| ||| |.:..
  Fly    68 CGTPNVNRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCV-HGNRDQITI 130

  Fly    89 DLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQL--ATED 150
            .|..|...|   ...|:...|.:..:||||.... .||:|:|:|:||:....|:..:.|  |..:
  Fly   131 RLLQIDRSS---RDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHN 192

  Fly   151 PPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY-SRLPETMIC--LLHSKNSGAC 212
            .....|| ::|||.|.|.|..|:.|..|.|..|:...||...| .::.|.|:|  |:......||
  Fly   193 FDGKTAV-VAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDAC 256

  Fly   213 YGDSGGPATYGG---KVVGLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            .||||||.....   |:.|:.|  .|.||. :.||..|.|:||...||
  Fly   257 QGDSGGPLIVNEGRYKLAGVVS--FGYGCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 83/234 (35%)
Tryp_SPc 37..219 CDD:238113 68/192 (35%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/234 (35%)
Tryp_SPc 76..305 CDD:238113 84/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.